Skip to content
OGN logo
Omnis Genomics
GPU-native genomics
Patent Checker
PatentChecker

Demo: NAVSEA proof bundle

A signed, deterministic proof bundle for a naval anti-biofouling coating use case: structured inputs, evidence artifacts, risk events, and a cross-platform replay verifier.

This is not legal advice. It demonstrates how PatentChecker packages technical assessments into forwardable, offline-verifiable artifacts for procurement and engineering review.

Download bundle SHA-256 Back to PatentChecker

Use case

Domain: biofouling-resistant coatings
Candidate sequence: MNSQKLLNQWQQAQKLEQANAALEQQVNQLAQQIAQQANQKLFK
Formulation: Peptide film plus zwitterionic linker over a corrosion-tolerant primer for submerged steel hull sections.
Pipeline version: 0.1.40
Why this matters

Defense and marine procurement requires reproducible technical assessments. This bundle shows how inputs, evidence, and verdicts can be hashed, signed, and verified offline by any stakeholder.

Bundle contents

  • bundle.json
    Canonical manifest with SHA-256 addressed files.
  • bundle.pdf
    Human-readable proof bundle report.
  • artifacts/inputs.json
    Structured request and candidate sequence inputs.
  • artifacts/config.json
    Pipeline configuration and thresholds.
  • artifacts/run_manifest.json
    Run-level metadata and provenance.
  • evidence/
    Citations, claim matches, risk events, and sequence hits.
  • verification/verify.sh
    Unix verifier for signature and hash integrity.
  • verification/verify.ps1
    Windows verifier for signature and hash integrity.
  • SHA256SUMS + SIGNATURE.ed25519
    File hashes and Ed25519 signature.

Verify offline

Checksum
28061e171368104e614bdc61102b9a155b2ee8a8c11964195c010642d5b41e5f
Download the bundle, verify the SHA-256, extract it, and run the verifier script for your platform.
Commands
# Verify and extract
curl -sL "/patent-checker/navsea_proof_bundle_v1.tar.gz" -o navsea_proof_bundle_v1.tar.gz
curl -sL "/patent-checker/navsea_proof_bundle_v1.tar.gz.sha256" -o navsea_proof_bundle_v1.tar.gz.sha256
sha256sum -c navsea_proof_bundle_v1.tar.gz.sha256

tar -xzf navsea_proof_bundle_v1.tar.gz -C navsea_bundle
cd navsea_bundle

# Run verifier (macOS/Linux)
./verification/verify.sh

# Or Windows
# pwsh -File .\verification/verify.ps1